PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I00663.1.p
Common NameEUGRSUZ_I00663, LOC104418415
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 359aa    MW: 40095.8 Da    PI: 6.3096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I00663.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEd +l+ +++q+G+g +W + ++++g++R++k+c++rw++yl
  Eucgr.I00663.1.p 14 KGPWSPEEDARLKAYIEQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                      79*********************************************97 PP

2Myb_DNA-binding38.33e-1269111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g++++eE+ ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Eucgr.I00663.1.p  69 GAFSEEEENIICSLYIAIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                       79*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.905962IPR017930Myb domain
SuperFamilySSF466891.47E-2611109IPR009057Homeodomain-like
SMARTSM007177.9E-131364IPR001005SANT/Myb domain
PfamPF002491.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-241569IPR009057Homeodomain-like
CDDcd001679.98E-101662No hitNo description
PROSITE profilePS5129421.98263117IPR017930Myb domain
SMARTSM007172.0E-1167115IPR001005SANT/Myb domain
PfamPF002495.5E-1169111IPR001005SANT/Myb domain
CDDcd001678.64E-870113No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDARLKAYIE QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNLKHGA FSEEEENIIC SLYIAIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLFGR  120
QPKERSTGRI TNGLKEEATK RDHKESSMVN GAGNGTINYN QYWPQLPDFA TPSALHEIPN  180
IPQHGSQSDL LTCVGARFSE DHLRSVFSTL DNFQNPIHIP PSPSLKFDML TEPLSNGLGS  240
FQSVNSMGCD TSQLSNPHFI STTQEAVPNA WNELQYFAND VGEDEAVYSN QQSSDVLLEV  300
FCGNCSSQAS STPESSYSWN DMSSLVDPST VSKYEPCRPE IQKDCSEPFR ELMYFGPQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-24141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I00663.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028053.10.0PREDICTED: transcription factor RAX3
TrEMBLA0A059AMT90.0A0A059AMT9_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.15e-83myb domain protein 84